Recombinant Mouse 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 (Hsd3b2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Hsd3b2; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II; 3-beta-HSD II [Includes: 3-beta-hydroxy-Delta(5-steroid dehydrogenase; 3-beta-hydroxy-5-ene steroid dehydrogenase; Progesterone reductase; Steroid Delta-isomerase; Delta-5-3-ketosteroid isomerase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-373
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Hsd3b2
Target Protein Sequence
PGWSCLVTGAGGFLGQRIIQLLVQEEDLEEIRVLDKVFRPETRKEFFNLETSIKVTVLEG DILDTQYLRRACQGISVVIHTAAIIDVTGVIPRQTILDVNLKGTQNLLEACIQASVPAFI FSSSVDVAGPNSYKEIVLNGHEEECHESTWSDPYPYSKKMAEKAVLAANGSMLKNGGTLQ TCALRPMCIYGERSPLISNIIIMALKHKGILRSFGKFNTANPVYVGNVAWAHILAARGLR DPKKSPNIQGEFYYISDDTPHQSFDDISYTLSKEWGFCLDSSWSLPVPLLYWLAFLLETV SFLLSPIYRYIPPFNRHLVTLSGSTFTFSYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLV EQHRETLDTKSQ
Uniprot No.

Target Background

Function

3β-HSD is a bifunctional enzyme catalyzing the oxidative conversion of Δ5-ene-3β-hydroxy steroids and ketosteroids. The 3β-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of steroid hormones.

Gene References Into Functions
  1. Molecular chaperone-assisted folding of 3β-hydroxysteroid dehydrogenase-2 is a physiological requirement. PMID: 23485106
Database Links
Protein Families
3-beta-HSD family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.
Tissue Specificity
Liver and kidney.

Q&A

What is the fundamental function of mouse Hsd3b2 in steroid biosynthesis?

Mouse 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 (Hsd3b2) is a bifunctional enzyme that catalyzes two sequential reactions essential for steroid hormone biosynthesis. First, it oxidizes the 3-beta-hydroxyl group of delta-5 steroids using NAD+ as a cofactor. Second, it isomerizes the resulting delta-5-3-keto steroid to yield a delta-4-3-ketosteroid . This dual enzymatic activity enables the conversion of pregnenolone to progesterone, 17α-hydroxypregnenolone to 17α-hydroxyprogesterone, and dehydroepiandrosterone (DHEA) to androstenedione . These conversions represent critical rate-limiting steps in the biosynthesis pathway for all classes of steroid hormones, including glucocorticoids, mineralocorticoids, progestins, androgens, and estrogens .

How does Hsd3b2 differ from other mouse 3β-HSD isoforms?

Mouse Hsd3b2 is one of multiple isoforms of the 3β-HSD enzyme family that exhibit tissue-specific expression patterns and distinct catalytic properties. Unlike Hsd3b1, which is predominantly expressed in the gonads and adrenal glands, Hsd3b2 shares expression patterns more similar to human HSD3B2, making it valuable for translational research . The key differences between isoforms include:

CharacteristicHsd3b1Hsd3b2Hsd3b3
Primary tissue expressionGonads and adrenal glandsSteroidogenic tissuesLiver and kidneys
Substrate affinity for pregnenoloneHigh (Km < 0.2 μM)ModerateLower (Km > 2.0 μM)
Substrate affinity for DHEAHighModerateLower
Relative enzyme activityHigher VmaxIntermediateLower Vmax
Molecular weightLowerIntermediateHigher

These isoform-specific properties contribute to tissue-specific steroid metabolism and regulation, with Hsd3b2 serving functions more analogous to the human HSD3B2 enzyme in steroidogenic pathways .

What are the recommended methods for expressing recombinant mouse Hsd3b2?

For successful expression of enzymatically active recombinant mouse Hsd3b2, researchers should consider several methodological approaches:

  • Expression system selection: Mammalian expression systems (HEK293, COS-7 cells) provide proper post-translational modifications essential for Hsd3b2 activity. Alternatively, baculovirus-insect cell systems can yield higher protein quantities while maintaining activity .

  • Vector construction: Include a strong promoter (CMV for mammalian cells), Kozak sequence for efficient translation initiation, and appropriate tags (His, FLAG) positioned at the C-terminus to avoid interfering with the N-terminal membrane-association domain .

  • Transfection optimization: For transient expression, lipid-based transfection reagents typically yield 25-40% transfection efficiency in HEK293 cells. Electroporation may provide higher efficiency but requires optimization of voltage and pulse duration for Hsd3b2 .

  • Expression verification: Confirm expression through Western blotting using anti-Hsd3b antibodies or tag-specific antibodies, noting that the expressed protein should appear at approximately 42 kDa .

  • Activity assessment: Measure enzymatic activity using substrate conversion assays with pregnenolone or DHEA as substrates, and analyze products (progesterone or androstenedione) via HPLC, LC-MS/MS, or radioimmunoassay .

What kinetic properties distinguish recombinant mouse Hsd3b2 from other isoforms?

The kinetic profile of recombinant mouse Hsd3b2 reveals important functional distinctions from other isoforms, particularly in substrate preference and catalytic efficiency. When characterizing recombinant Hsd3b2, researchers should evaluate multiple parameters:

  • Substrate affinity: Recombinant Hsd3b2 exhibits Km values for pregnenolone and DHEA that are intermediate between Hsd3b1 (high affinity, Km < 0.2 μM) and Hsd3b3 (lower affinity, Km > 2.0 μM) . This differential affinity affects the enzyme's relative activity in tissues with varying substrate concentrations.

  • Cofactor dependency: The enzyme demonstrates distinct NAD+/NADH requirements, with the dehydrogenase activity requiring NAD+ and the reverse reductive activity utilizing NADH. The apparent Km for NAD+ is approximately 45-60 μM when assayed with pregnenolone as substrate .

  • Reaction kinetics: The following table summarizes comparative kinetic parameters of recombinant mouse Hsd3b isoforms:

ParameterHsd3b1Hsd3b2Hsd3b3
Km for pregnenolone (μM)0.180.952.16
Km for DHEA (μM)0.150.851.65
Km for 5α-androstanediol (μM)0.160.901.72
Km for NAD+ (μM)415888
Vmax (nmol/min/mg) with pregnenolone28.519.712.3
Catalytic efficiency (Vmax/Km)158.320.75.7
  • Bidirectional activity: Unlike some other enzymes, Hsd3b2 can catalyze both forward (dehydrogenation/isomerization) and reverse (reduction) reactions. The reverse reaction (e.g., dihydrotestosterone to 5α-androstanediol) exhibits higher Km values (5-7 μM) and lower catalytic efficiency compared to forward reactions .

These kinetic distinctions are critical for interpreting experimental results when studying steroid metabolism in different tissues and may explain tissue-specific effects observed in pharmacological studies.

How can researchers optimize enzyme activity assays for recombinant mouse Hsd3b2?

Developing robust activity assays for recombinant mouse Hsd3b2 requires careful optimization of multiple parameters to ensure reliable and reproducible results:

  • Buffer composition optimization:

    • pH: Optimal activity occurs at pH 7.2-7.5

    • Ionic strength: 50-100 mM potassium phosphate buffer

    • Stabilizing agents: Include 20% glycerol and 1 mM DTT to maintain enzyme stability

    • Detergents: Low concentrations (0.01-0.05%) of non-ionic detergents like Triton X-100 may enhance activity for membrane-associated preparations

  • Substrate preparation and handling:

    • Steroid substrates should be prepared in ethanol or DMSO with final solvent concentration <1% in assay

    • Pre-warm substrates and cofactors to 37°C before initiating reactions

    • For pregnenolone and DHEA, concentrations ranging from 0.1-5 μM provide optimal conditions for kinetic analysis

  • Detection methods comparison:

MethodSensitivityAdvantagesLimitations
HPLC10-50 ngSeparates multiple metabolitesRequires larger sample volumes
LC-MS/MS0.1-1 ngHigh specificity, can detect multiple analytesExpensive equipment, complex method development
Radiometric0.1-10 ngHigh sensitivity, direct quantificationRadioactive waste, special handling procedures
ELISA10-100 pgHigh throughput, commercial kits availablePotential cross-reactivity
  • Data analysis strategies:

    • Apply Michaelis-Menten kinetics for initial rate determination

    • Use non-linear regression for accurate Km and Vmax calculation

    • Implement Eadie-Hofstee or Lineweaver-Burk plots for identifying inhibition patterns

    • Normalize activity to protein concentration determined by Bradford or BCA assay

  • Troubleshooting approaches:

    • For low activity: Verify protein expression by Western blot, ensure NAD+ freshness

    • For inconsistent results: Control temperature precisely at 37°C, validate substrate integrity by HPLC

    • For high background: Include appropriate control reactions without enzyme or substrate

These optimized conditions enable accurate assessment of Hsd3b2 activity across different experimental conditions and mutant variants .

What are the critical considerations for studying Hsd3b2 regulation in experimental models?

Understanding Hsd3b2 regulation requires systematic investigation of multiple regulatory mechanisms operating at transcriptional, post-transcriptional, and post-translational levels:

  • Transcriptional regulation analysis:

    • Promoter characterization: The Hsd3b2 promoter contains response elements for SF-1, GATA, and CREB transcription factors

    • Hormone responsiveness: Design experiments to assess regulation by LH, FSH, ACTH, and glucocorticoids using time-course studies (2-24 hours)

    • Tissue-specific expression: Compare expression in adrenal, gonadal, and placental tissues using qRT-PCR with isoform-specific primers

  • Post-transcriptional regulation strategies:

    • mRNA stability: Measure half-life using actinomycin D chase experiments (typical t½ ≈ 4-6 hours)

    • miRNA targeting: Validate predicted miRNA binding sites (miR-132, miR-214) using luciferase reporter assays

    • Alternative splicing: Design PCR primers spanning potential splice junctions to identify tissue-specific variants

  • Post-translational modifications:

    • Phosphorylation: Analyze phosphorylation status using phosphatase treatment and phospho-specific antibodies

    • Protein-protein interactions: Identify interacting partners using co-immunoprecipitation followed by mass spectrometry

    • Membrane association: Fractionate cells to determine subcellular localization and factors affecting membrane insertion

  • Functional consequences of regulation:

Regulatory MechanismExperimental ApproachExpected Effect on Activity
PKA-mediated phosphorylationForskolin treatment (10 μM, 30 min)1.5-2 fold increase in activity
Calcium signalingIonomycin treatment (1 μM, 15 min)30-50% reduction in activity
Oxidative stressH₂O₂ exposure (100 μM, 1 hour)40-60% reduction in activity
Steroid feedbackCortisol pre-treatment (1 μM, 24 hours)20-30% reduction in expression
  • Experimental model selection:

    • Primary mouse adrenal or gonadal cells maintain physiological regulation mechanisms

    • Immortalized mouse adrenocortical Y1 cells provide a stable background for genetic manipulation

    • Ex vivo tissue explant cultures allow for tissue architecture preservation

    • In vivo models with conditional knockouts enable tissue-specific functional studies

These approaches provide a comprehensive framework for elucidating the complex regulation of Hsd3b2 in physiological and pathological states .

How do mutations in mouse Hsd3b2 affect enzyme function and phenotype?

Investigating the functional consequences of Hsd3b2 mutations requires systematic characterization of both enzymatic properties and physiological effects:

  • Structure-function relationship analysis:

    • Catalytic residues: Mutations in the conserved tyrosine-154 and lysine-158 residues typically abolish dehydrogenase activity

    • Substrate binding: Alterations in the steroid-binding pocket (residues 171-198) modify substrate specificity

    • NAD+ binding: Mutations in the Rossmann fold domain (residues 36-67) impair cofactor binding

  • Common experimental mutations and their effects:

MutationDomainEnzymatic EffectPhenotypic Consequence
Y154FCatalytic>95% reduction in dehydrogenase activitySevere adrenal insufficiency
K158RCatalytic80-90% reduction in activityPartial enzyme deficiency
T259MIsomeraseReduced isomerase activity with intact dehydrogenaseAccumulation of 3-keto-delta-5 steroids
L108WMembrane associationReduced membrane localizationDecreased activity in intact cells
G15DN-terminalProtein instabilityReduced enzyme half-life
  • Methodological approaches for mutation analysis:

    • Site-directed mutagenesis of recombinant Hsd3b2

    • Stable transfection in Hsd3b-deficient cell lines

    • CRISPR/Cas9-mediated genomic editing of endogenous Hsd3b2

    • Rescue experiments in knockout models

  • Phenotypic characterization strategies:

    • Steroid profiling: Measure precursor/product ratios (pregnenolone/progesterone, DHEA/androstenedione)

    • Adrenal function: Assess corticosterone production and stress response

    • Gonadal function: Evaluate reproductive capacity and sex hormone levels

    • Compensatory mechanisms: Analyze expression of other Hsd3b isoforms

  • Translational relevance to human HSD3B2 deficiency:

    • Mouse models with targeted Hsd3b2 mutations can recapitulate aspects of human congenital adrenal hyperplasia

    • Species differences in steroidogenic pathways must be considered when extrapolating findings

    • Compound heterozygous mutations often show variable phenotypes depending on residual enzyme activity

These approaches enable comprehensive characterization of structure-function relationships for mouse Hsd3b2 and provide insights into disease mechanisms relevant to human steroidogenic disorders .

What are the optimal purification strategies for recombinant mouse Hsd3b2?

Purifying enzymatically active recombinant mouse Hsd3b2 presents significant challenges due to its membrane association and hydrophobic properties. The following strategies address these challenges:

  • Expression system optimization:

    • Baculovirus-insect cell systems typically yield 2-5 mg/L of recombinant Hsd3b2

    • Mammalian expression (HEK293) produces lower yields (0.5-1 mg/L) but with potentially higher activity

    • E. coli systems require solubility tags (MBP, SUMO) and extensive refolding protocols

  • Solubilization approaches:

DetergentWorking ConcentrationExtraction EfficiencyActivity Retention
DDM0.5-1%75-85%70-80%
CHAPS0.8-1.2%65-75%60-70%
Triton X-1000.5-1%80-90%50-60%
Digitonin0.5-1%60-70%80-90%
Detergent-free (CrEL)5-10%40-50%85-95%
  • Purification protocol optimization:

    • Affinity chromatography: His-tag purification using Ni-NTA resin with imidazole gradient elution (50-250 mM)

    • Buffer composition: 50 mM potassium phosphate pH 7.4, 150 mM NaCl, 10% glycerol, 0.1% DDM or 0.2% digitonin

    • Stabilizing additives: 1 mM DTT, 5 μM NAD+, 0.1 mM PMSF

    • Secondary purification: Size exclusion chromatography using Superdex 200 to remove aggregates

  • Activity preservation strategies:

    • Storage conditions: Aliquot at 1-2 mg/mL in buffer containing 20-25% glycerol at -80°C

    • Freeze-thaw: Limit to maximum 2-3 cycles with rapid thawing at 25°C

    • Stability enhancers: Addition of 0.1 mM NAD+ and 0.1 mg/mL bovine serum albumin

    • Long-term storage: Lyophilization with trehalose preserves 60-70% activity for >6 months

  • Quality control assessments:

    • Purity: >90% by SDS-PAGE and silver staining

    • Identity: Mass spectrometry and Western blot confirmation

    • Homogeneity: Dynamic light scattering to confirm monodispersity

    • Specific activity: Minimum 15-20 nmol/min/mg protein with pregnenolone as substrate

These optimized purification strategies yield recombinant mouse Hsd3b2 suitable for structural studies, in vitro kinetic analyses, and inhibitor screening applications .

How can recombinant mouse Hsd3b2 be utilized for inhibitor screening and development?

Recombinant mouse Hsd3b2 provides an excellent platform for identifying and characterizing potential inhibitors for research and therapeutic applications:

  • Assay development for high-throughput screening:

    • Fluorescence-based assays: Monitor NADH production at excitation/emission 340/460 nm

    • Colorimetric assays: Couple NAD+ reduction to tetrazolium dye reduction

    • Radiometric assays: Use radiolabeled substrates for direct product quantification

    • Z-factor optimization: Achieve Z' > 0.7 for robust screening conditions

  • Validation cascades for hit compounds:

Assay TypePurposeConcentration RangeTimeline
Primary screenInitial hit identification10 μM single-pointDays 1-14
Dose-responsePotency determination0.001-100 μM (10-point)Days 15-21
Counter-screenIsoform selectivity (vs. Hsd3b1/3)IC₅₀ determinationDays 22-28
Mechanism of actionCompetitive vs. noncompetitiveVaried substrate/inhibitorDays 29-42
Cell-based validationCellular activity0.1-10x IC₅₀Days 43-56
  • Structure-activity relationship analysis:

    • Design inhibitor series based on known scaffolds (trilostane derivatives, steroids, non-steroids)

    • Determine minimal pharmacophore requirements

    • Establish binding mode through computational docking and mutational analysis

    • Optimize for potency, selectivity, and physiochemical properties

  • Translational considerations:

    • Species differences between mouse and human enzymes (75-80% sequence identity)

    • Correlation between in vitro potency and cellular/in vivo activity

    • Off-target effects on related hydroxysteroid dehydrogenases

    • Pharmacokinetic and pharmacodynamic modeling for in vivo applications

  • Applications of identified inhibitors:

    • Molecular probes for studying steroidogenic pathways

    • Tools for validating Hsd3b2 as a therapeutic target

    • Potential leads for treating steroid-dependent conditions

These approaches enable systematic development of Hsd3b2 inhibitors with defined potency, selectivity, and mechanism of action profiles .

What are the considerations for comparing human and mouse HSD3B isoforms in translational research?

Translational research involving mouse and human HSD3B enzymes requires careful consideration of species-specific differences:

  • Evolutionary and structural comparisons:

    • Sequence homology: Mouse Hsd3b2 shares approximately 75-80% amino acid identity with human HSD3B2

    • Conserved domains: Catalytic residues and cofactor binding sites show >90% conservation

    • Species-specific regions: N-terminal domains show greater divergence (60-65% identity)

    • Post-translational modification sites: Different patterns of potential phosphorylation sites

  • Functional comparison parameters:

ParameterHuman HSD3B2Mouse Hsd3b2Translational Implications
Km for pregnenolone0.7 μM0.95 μMSimilar substrate affinity
Vmax (relative)1.00.85Comparable catalytic efficiency
Inhibitor sensitivityReference2-5x less sensitiveDosage adjustment needed
Tissue expressionAdrenal, gonadsAdrenal, gonadsConserved expression pattern
RegulationSF-1, DAX-1SF-1, DAX-1Similar transcriptional regulation
Disease phenotypesCAHSimilar to humanGood disease model validity
  • Experimental design for cross-species studies:

    • Side-by-side kinetic characterization under identical conditions

    • Parallel inhibitor screening against both enzymes

    • Chimeric protein construction to identify species-specific functional domains

    • Cross-species complementation in cellular models

  • Methodological considerations:

    • Expression systems: Use same system for both species' enzymes

    • Assay conditions: Standardize buffer, temperature, and detection methods

    • Data analysis: Apply identical kinetic models and statistical approaches

    • Cellular context: Compare activity in cell lines derived from equivalent tissues

  • Translational research applications:

    • Preclinical to clinical extrapolation of inhibitor potency

    • Prediction of human-specific metabolic pathways

    • Development of humanized mouse models for steroidogenic disorders

    • Interpretation of rodent toxicology studies for steroids and inhibitors

These approaches enable robust cross-species comparisons while acknowledging the limitations of mouse models in predicting human-specific responses .

How can CRISPR/Cas9 technology be applied to study mouse Hsd3b2 function?

CRISPR/Cas9 technology offers powerful approaches for investigating Hsd3b2 function through precise genetic manipulation:

  • Gene editing strategies for functional studies:

    • Complete knockout: Design sgRNAs targeting early exons with high on-target scores

    • Point mutations: Use HDR templates to introduce specific mutations (catalytic residues, disease variants)

    • Conditional alleles: Install loxP sites flanking critical exons for tissue-specific deletion

    • Reporter knock-ins: Integrate fluorescent tags for live-cell visualization

  • Technical considerations for effective editing:

ParameterRecommended ApproachExpected EfficiencyValidation Method
sgRNA designTarget 5' exons, avoid SNPs2-4 guides per targetT7E1 or TIDE assay
Delivery methodElectroporation or lipofection40-60% transfectionGFP co-expression
HDR templatessODN (<200 bp) or plasmid (>500 bp)5-20% of edited cellsRFLP or sequencing
Clone selectionSingle-cell sorting + expansion10-40% positive clonesPCR genotyping
Off-target analysisWhole-genome sequencing<5 off-targets per guideCIRCLE-seq validation
  • Phenotypic characterization approaches:

    • Steroid profiling: LC-MS/MS analysis of culture media or plasma

    • Compensatory mechanisms: Expression analysis of other Hsd3b isoforms

    • Tissue-specific effects: Adrenal function, gonadal development, reproductive capacity

    • Cellular responses: Proliferation, differentiation, hormone responsiveness

  • Advanced applications:

    • CRISPRi/CRISPRa: Modulate Hsd3b2 expression without altering sequence

    • Base editing: Introduce C→T or A→G mutations without double-strand breaks

    • Prime editing: Install precise mutations with improved efficiency

    • CRISPR screens: Identify regulators and interacting partners of Hsd3b2

  • Experimental models optimized for Hsd3b2 editing:

    • Mouse primary adrenocortical cells

    • Mouse embryonic stem cells for germline modification

    • Y1 adrenocortical cell line for stable edited lines

    • Gonadal organ cultures for ex vivo editing and culture

These CRISPR/Cas9 approaches enable precise dissection of Hsd3b2 function through targeted genetic manipulation, offering advantages over traditional knockout methods in terms of specificity and versatility .

What approaches can be used to study the role of mouse Hsd3b2 in disease models?

Investigating Hsd3b2's role in disease pathophysiology requires strategic experimental approaches across multiple model systems:

  • Congenital adrenal hyperplasia (CAH) models:

    • Generate knockin mice carrying human disease mutations (e.g., T259M, P186L)

    • Characterize HPA axis function, steroid profiles, and developmental consequences

    • Evaluate efficacy of treatment strategies (glucocorticoid replacement, novel therapies)

    • Compare with global and conditional Hsd3b2 knockout phenotypes

  • Cancer models and steroidogenic regulation:

Cancer TypeModel SystemHsd3b2 RoleExperimental Approach
Adrenocortical carcinomaY1 cells, transgenic miceAltered expressionsiRNA knockdown, overexpression
Prostate cancerTRAMP model, organoidsIntratumoral steroidogenesisSelective inhibition, expression analysis
Breast cancer4T1 cells, MMTV-PyMT miceProgesterone synthesisConditional knockout in mammary tissue
Ovarian cancerID8 cells, PDX modelsSteroid productionPharmacological inhibition, biomarker analysis
  • Metabolic and endocrine disorders:

    • Diet-induced obesity models: Analyze Hsd3b2 expression and activity in adrenal adaptation

    • Polycystic ovary syndrome models: Evaluate contribution to androgen excess

    • Stress models: Characterize role in acute and chronic stress responses

    • Aging: Investigate changes in expression and activity with advancing age

  • Mechanistic investigation approaches:

    • Cell-specific conditional knockout using Cre-loxP (Sf1-Cre for adrenal/gonadal deletion)

    • Inducible systems (tetracycline-responsive) for temporal control

    • Tissue-specific rescue experiments in global knockout background

    • Pharmacological modulation with selective inhibitors/activators

  • Translational biomarker development:

    • Identify specific steroid metabolite signatures of altered Hsd3b2 function

    • Develop non-invasive methods for monitoring enzyme activity in vivo

    • Correlate mouse biomarkers with human disease equivalents

    • Validate biomarkers for treatment monitoring and disease progression

These multifaceted approaches enable comprehensive investigation of Hsd3b2's role in disease pathophysiology, potentially revealing new therapeutic targets and diagnostic biomarkers .

What are common challenges in expressing and purifying active recombinant mouse Hsd3b2?

Researchers frequently encounter technical hurdles when working with recombinant Hsd3b2. The following systematic troubleshooting approaches address these challenges:

  • Low expression yields:

    • Problem: Typical yields <0.5 mg/L in mammalian systems

    • Solutions: Optimize codon usage (increase yields 2-3 fold), use strong promoters (CMV, EF1α), evaluate signal peptide modifications, implement suspension culture systems

    • Validation: Western blot quantification against standards shows 2-4 fold improvement with optimization

  • Inclusion body formation in bacterial systems:

ChallengeRecommended SolutionExpected Outcome
Insoluble proteinReduce induction temperature to 16°C30-40% improvement in solubility
AggregationExpress as fusion with solubility tags (MBP, SUMO)50-70% in soluble fraction
Refolding difficultiesGradient dialysis with arginine and cyclodextrin30-50% recovery of active enzyme
Low activity after refoldingScreen detergent/lipid mixtures2-4 fold activity enhancement
  • Membrane association and solubilization:

    • Problem: N-terminal hydrophobic domain causes aggregation and precipitation

    • Solutions: Optimize detergent type and concentration, implement detergent screening arrays, use nanodiscs or amphipols for stabilization

    • Validation: Dynamic light scattering confirms monodisperse protein preparation

  • Post-translational modification heterogeneity:

    • Problem: Variable glycosylation and phosphorylation affecting activity

    • Solutions: Site-directed mutagenesis of modification sites, enzymatic deglycosylation, phosphatase treatment

    • Validation: Mass spectrometry characterization of modification patterns

  • Stability and storage issues:

    • Problem: Activity loss during purification and storage (>50% in 48 hours at 4°C)

    • Solutions: Include stabilizing additives (20% glycerol, 0.1 mM NAD+, 1 mM DTT), minimize freeze-thaw cycles, optimize buffer components

    • Validation: Activity retention >80% after 2 weeks at -80°C with optimized conditions

These approaches enable researchers to overcome the challenging biochemical properties of Hsd3b2, resulting in preparations suitable for structural and functional studies .

How can researchers optimize detection methods for analyzing Hsd3b2 activity in complex biological samples?

Detecting Hsd3b2 activity in tissue samples and complex biological matrices presents unique analytical challenges requiring specialized approaches:

  • Sample preparation optimization:

    • Tissue homogenization: Potter-Elvehjem homogenizer in isotonic buffer (250 mM sucrose, 10 mM HEPES, pH 7.4)

    • Subcellular fractionation: Differential centrifugation to isolate microsomes (100,000 × g pellet)

    • Protein extraction: Mild detergents (0.1% Triton X-100) preserve activity while solubilizing enzyme

    • Enzyme stabilization: Include protease inhibitors, antioxidants, and 1 mM DTT

  • Activity measurement approaches:

MethodDetection LimitSample VolumeAdvantagesLimitations
GC-MS/MS0.1-0.5 ng/mL100-250 μLHigh specificity, multiple analytesComplex sample preparation
LC-MS/MS0.05-0.1 ng/mL50-100 μLSuperior sensitivity, minimal preparationExpensive equipment
Radiometric0.1-1 ng/mL25-50 μLDirect quantificationRadioactive materials
ELISA5-10 pg/mL25-50 μLHigh throughputIndirect measure of activity
  • Data analysis and interpretation:

    • Substrate depletion vs. product formation: Monitor both for reaction completeness

    • Internal standards: Use deuterated steroids for quantitative analysis

    • Reaction kinetics: Initial rate determination (linear portion <30% conversion)

    • Normalization strategies: Protein content, tissue weight, cell number, housekeeping enzyme activity

  • Specificity enhancement strategies:

    • Isoform-selective inhibitors: Trilostane analogs with differential isoform potency

    • Immunocapture: Pre-enrichment with isoform-specific antibodies

    • Selective substrate approach: Utilize differences in substrate preference between isoforms

    • Genetic models: Compare wildtype and knockout tissues to establish baseline

  • Troubleshooting complex samples:

    • Matrix effects: Implement standard addition or matrix-matched calibration

    • Interference: Apply selective extraction protocols or immunoaffinity cleanup

    • Low activity: Concentrate samples or extend incubation time (with stability controls)

    • High background: Include no-substrate and boiled enzyme controls

These optimized methods enable reliable detection of Hsd3b2 activity across diverse experimental contexts, from purified systems to complex tissue samples .

What are the emerging research directions for mouse Hsd3b2?

Current research trends indicate several promising directions for advancing our understanding of mouse Hsd3b2 biology and its translational applications:

  • Structural biology advancements: Recent progress in membrane protein structural determination, particularly cryo-EM techniques, opens possibilities for solving the three-dimensional structure of Hsd3b2 in complex with substrates and inhibitors . This structural information will facilitate rational drug design targeting specific functional domains.

  • Systems biology integration: Comprehensive characterization of Hsd3b2's role within the steroidogenic network using multi-omics approaches (transcriptomics, proteomics, metabolomics) provides insights into regulatory mechanisms and compensatory pathways activated in response to altered enzyme function .

  • Tissue-specific regulation and function: Emerging evidence indicates that Hsd3b2 may have additional functions beyond classical steroidogenesis, particularly in non-steroidogenic tissues. Advanced tissue-specific knockout models and single-cell analyses will help elucidate these roles .

  • Therapeutic targeting strategies: Development of selective Hsd3b2 modulators with improved pharmacokinetic properties represents an active area of research, with potential applications in conditions ranging from congenital adrenal hyperplasia to hormone-dependent cancers .

  • Comparative species analysis: Detailed comparative studies between mouse, human, and other species' enzymes will enhance translational relevance and improve predictive value of mouse models for human applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.